SCOPe 2.02: Domain d4htua_: 4htu A:

Lineage for d4htua_ (4htu A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (16 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d4htua_: 4htu A: [192575]
   automated match to d1zbfa1
   protein/DNA complex; complexed with edo, gol, mg

Details for d4htua_

PDB Entry: 4htu, 1.49 Å

PDB Description: Structure of 5-chlorouracil modified A:U base pair

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d4htua_:

Sequence; same for both SEQRES and ATOM records:

>d4htua_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg

Timeline for d4htua_:

• d4htua_ is new in SCOPe 2.02-stable
  
• d4htua_ appears in SCOPe 2.03
  
• d4htua_ appears in the current release, SCOPe 2.08