Lineage for d4ar6a_ (4ar6 A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464256Species Pyrococcus furiosus [TaxId:2261] [57809] (25 PDB entries)
    Uniprot P24297
  8. 1464257Domain d4ar6a_: 4ar6 A: [192572]
    automated match to d3kyua_
    complexed with dod, fe

Details for d4ar6a_

PDB Entry: 4ar6 (more details), 0.92 Å

PDB Description: X-ray crystallographic structure of the reduced form perdeuterated Pyrococcus furiosus rubredoxin at 295 K (in quartz capillary) to 0.92 Angstroms resolution.
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d4ar6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ar6a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d4ar6a_:

Click to download the PDB-style file with coordinates for d4ar6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ar6a_: