Lineage for d4i08a_ (4i08 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1152087Protein automated matches [190085] (34 species)
    not a true protein
  7. 1152358Species Vibrio cholerae [TaxId:243277] [189479] (7 PDB entries)
  8. 1152368Domain d4i08a_: 4i08 A: [192571]
    automated match to d3rshb_
    complexed with edo, ndp, so4

Details for d4i08a_

PDB Entry: 4i08 (more details), 2.06 Å

PDB Description: crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with nadph
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4i08a_:

Sequence, based on SEQRES records: (download)

>d4i08a_ c.2.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
nggmymi

Sequence, based on observed residues (ATOM records): (download)

>d4i08a_ c.2.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
tvapgfietdmndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvnggm
ymi

SCOPe Domain Coordinates for d4i08a_:

Click to download the PDB-style file with coordinates for d4i08a_.
(The format of our PDB-style files is described here.)

Timeline for d4i08a_:

  • d4i08a_ appears in periodic updates to SCOPe 2.02 starting on 2013-03-20
  • d4i08a_ appears in SCOPe 2.03
  • d4i08a_ appears in the current release, SCOPe 2.07, called d4i08a1