Lineage for d4hrte1 (4hrt E:4-149)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299610Protein Hemoglobin I [46464] (2 species)
  7. 2299611Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2299630Domain d4hrte1: 4hrt E:4-149 [192570]
    Other proteins in same PDB: d4hrta2, d4hrtb1, d4hrtb2, d4hrtc2, d4hrtd1, d4hrtd2, d4hrte2, d4hrtf1, d4hrtf2, d4hrtg2, d4hrth1, d4hrth2
    automated match to d1scta_
    complexed with hem, po4

Details for d4hrte1

PDB Entry: 4hrt (more details), 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded
PDB Compounds: (E:) Globin-2 A chain

SCOPe Domain Sequences for d4hrte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrte1 a.1.1.2 (E:4-149) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
avakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkgkan
sklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmketlk
armgnyysddvagawaalvgvvqaal

SCOPe Domain Coordinates for d4hrte1:

Click to download the PDB-style file with coordinates for d4hrte1.
(The format of our PDB-style files is described here.)

Timeline for d4hrte1: