Lineage for d4hrte_ (4hrt E:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1253929Protein Hemoglobin I [46464] (2 species)
  7. 1253930Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)
  8. 1253945Domain d4hrte_: 4hrt E: [192570]
    Other proteins in same PDB: d4hrtb_, d4hrtd_, d4hrtf_, d4hrth_
    automated match to d1scta_
    complexed with hem, po4

Details for d4hrte_

PDB Entry: 4hrt (more details), 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded
PDB Compounds: (E:) Globin-2 A chain

SCOPe Domain Sequences for d4hrte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrte_ a.1.1.2 (E:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
tlkarmgnyysddvagawaalvgvvqaal

SCOPe Domain Coordinates for d4hrte_:

Click to download the PDB-style file with coordinates for d4hrte_.
(The format of our PDB-style files is described here.)

Timeline for d4hrte_: