Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein 2MIHB/C-IAP-1 [57926] (1 species) baculoviral inhibitor of apoptosis |
Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries) |
Domain d4eb9d1: 4eb9 D:254-355 [192568] Other proteins in same PDB: d4eb9c2, d4eb9d2 automated match to d1qbha_ complexed with 0o6, zn |
PDB Entry: 4eb9 (more details), 2.6 Å
SCOPe Domain Sequences for d4eb9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eb9d1 g.52.1.1 (D:254-355) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg ddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls
Timeline for d4eb9d1:
View in 3D Domains from other chains: (mouse over for more information) d4eb9a_, d4eb9b_, d4eb9c1, d4eb9c2 |