Lineage for d3vf7a_ (3vf7 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (20 PDB entries)
  8. 1548399Domain d3vf7a_: 3vf7 A: [192559]
    automated match to d3pwma_
    complexed with 031, cl, gol, na; mutant

Details for d3vf7a_

PDB Entry: 3vf7 (more details), 1.3 Å

PDB Description: crystal structure of hiv-1 protease mutant l76v with novel p1'-ligands grl-02031
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3vf7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vf7a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3vf7a_:

Click to download the PDB-style file with coordinates for d3vf7a_.
(The format of our PDB-style files is described here.)

Timeline for d3vf7a_: