Lineage for d3vcea_ (3vce A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049384Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2049385Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2049386Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2049394Protein Thaumatin [49876] (1 species)
  7. 2049395Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (90 PDB entries)
    Uniprot P02883
  8. 2049466Domain d3vcea_: 3vce A: [192551]
    automated match to d1thva_
    complexed with gol

Details for d3vcea_

PDB Entry: 3vce (more details), 2.3 Å

PDB Description: Thaumatin by LB based Hanging Drop Vapour Diffusion after 18.1 MGy X-Ray dose at ESRF ID29 beamline (Best Case)
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d3vcea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vcea_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d3vcea_:

Click to download the PDB-style file with coordinates for d3vcea_.
(The format of our PDB-style files is described here.)

Timeline for d3vcea_: