![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (10 species) |
![]() | Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries) Uniprot P02185 |
![]() | Domain d4h0ba_: 4h0b A: [192548] automated match to d3obda_ complexed with dms, edo, hem, oxy, so4 |
PDB Entry: 4h0b (more details), 1.26 Å
SCOPe Domain Sequences for d4h0ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0ba_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase dlkkhtvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh pgdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d4h0ba_: