Lineage for d4h0ba_ (4h0b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301307Protein Myoglobin [46469] (10 species)
  7. 2301477Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. 2301550Domain d4h0ba_: 4h0b A: [192548]
    automated match to d3obda_
    complexed with dms, edo, hem, oxy, so4

Details for d4h0ba_

PDB Entry: 4h0b (more details), 1.26 Å

PDB Description: complex of g65t myoglobin with dmso in its distal cavity
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d4h0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0ba_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhtvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d4h0ba_:

Click to download the PDB-style file with coordinates for d4h0ba_.
(The format of our PDB-style files is described here.)

Timeline for d4h0ba_: