Lineage for d4f7eb_ (4f7e B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1290589Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)
  8. 1290596Domain d4f7eb_: 4f7e B: [192542]
    Other proteins in same PDB: d4f7ea1, d4f7ea2
    automated match to d2xfxb_
    complexed with 0sh, nag, so4

Details for d4f7eb_

PDB Entry: 4f7e (more details), 2.4 Å

PDB Description: crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d4f7eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7eb_ b.1.1.2 (B:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

SCOPe Domain Coordinates for d4f7eb_:

Click to download the PDB-style file with coordinates for d4f7eb_.
(The format of our PDB-style files is described here.)

Timeline for d4f7eb_: