Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries) |
Domain d4f7eb_: 4f7e B: [192542] Other proteins in same PDB: d4f7ea1, d4f7ea2, d4f7ea3 automated match to d2xfxb_ complexed with 0sh, nag, so4 |
PDB Entry: 4f7e (more details), 2.4 Å
SCOPe Domain Sequences for d4f7eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7eb_ b.1.1.2 (B:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]} iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
Timeline for d4f7eb_: