Lineage for d4f7cb_ (4f7c B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025135Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)
  8. 2025144Domain d4f7cb_: 4f7c B: [192541]
    Other proteins in same PDB: d4f7ca1, d4f7ca2, d4f7ca3, d4f7cc1, d4f7cc2, d4f7cc3
    automated match to d2xfxb_
    complexed with 0sg

Details for d4f7cb_

PDB Entry: 4f7c (more details), 2.86 Å

PDB Description: crystal structure of bovine cd1d with bound c12-di-sulfatide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d4f7cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7cb_ b.1.1.2 (B:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrd

SCOPe Domain Coordinates for d4f7cb_:

Click to download the PDB-style file with coordinates for d4f7cb_.
(The format of our PDB-style files is described here.)

Timeline for d4f7cb_: