Lineage for d4bara_ (4bar A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2777888Protein Thaumatin [49876] (1 species)
  7. 2777889Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries)
    Uniprot P02883
  8. 2777907Domain d4bara_: 4bar A: [192540]
    automated match to d1kwna_
    complexed with eu3, ikx

Details for d4bara_

PDB Entry: 4bar (more details), 1.2 Å

PDB Description: thaumatin from thaumatococcus daniellii structure in complex with the europium tris-hydroxyethyltriazoledipicolinate complex at 1.20 a resolution.
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d4bara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bara_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d4bara_:

Click to download the PDB-style file with coordinates for d4bara_.
(The format of our PDB-style files is described here.)

Timeline for d4bara_: