![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
![]() | Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
![]() | Family a.158.1.1: F-box domain [81381] (4 proteins) |
![]() | Protein Skp2 [81379] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
![]() | Domain d1fqva1: 1fqv A:107-145 [19254] Other proteins in same PDB: d1fqva2, d1fqvb1, d1fqvb2, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo2, d1fqvp1, d1fqvp2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqva1 a.158.1.1 (A:107-145) Skp2 {Human (Homo sapiens) [TaxId: 9606]} vswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d1fqva1:
![]() Domains from other chains: (mouse over for more information) d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp1, d1fqvp2 |