SCOPe 2.02: Domain d3v88a_: 3v88 A:

Lineage for d3v88a_ (3v88 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (47 PDB entries)
   Uniprot P02883

8. Domain d3v88a_: 3v88 A: [192537]
   automated match to d1thva_
   complexed with gol

Details for d3v88a_

PDB Entry: 3v88, 2.3 Å

PDB Description: Thaumatin by Classical Hanging Drop Vapour Diffusion after 18.1 MGy X-Ray dose at ESRF ID29 beamline (Best Case)

PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d3v88a_:

Sequence; same for both SEQRES and ATOM records:

>d3v88a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d3v88a_:

• d3v88a_ is new in SCOPe 2.02-stable
  
• d3v88a_ appears in SCOPe 2.03
  
• d3v88a_ appears in the current release, SCOPe 2.08