Lineage for d1fs1d1 (1fs1 D:84-140)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545442Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 545443Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 545444Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 545449Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 545450Species Human (Homo sapiens) [TaxId:9606] [81376] (5 PDB entries)
  8. 545452Domain d1fs1d1: 1fs1 D:84-140 [19253]
    Other proteins in same PDB: d1fs1a1, d1fs1b2, d1fs1c1, d1fs1d2

Details for d1fs1d1

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1d1 a.157.1.1 (D:84-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

SCOP Domain Coordinates for d1fs1d1:

Click to download the PDB-style file with coordinates for d1fs1d1.
(The format of our PDB-style files is described here.)

Timeline for d1fs1d1: