![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
![]() | Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) ![]() |
![]() | Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81376] (5 PDB entries) |
![]() | Domain d1fs1d1: 1fs1 D:84-140 [19253] Other proteins in same PDB: d1fs1a1, d1fs1b2, d1fs1c1, d1fs1d2 |
PDB Entry: 1fs1 (more details), 1.8 Å
SCOP Domain Sequences for d1fs1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs1d1 a.157.1.1 (D:84-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)} dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
Timeline for d1fs1d1:
![]() Domains from other chains: (mouse over for more information) d1fs1a1, d1fs1b1, d1fs1b2, d1fs1c1 |