SCOP 1.55: Domain d1fs1d1: 1fs1 D:84-140

Lineage for d1fs1d1 (1fs1 D:84-140)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)

4. Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family)

5. Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)

6. Protein Skp1-Skp2 dimerisation domains [48505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48506] (3 PDB entries)

8. Domain d1fs1d1: 1fs1 D:84-140 [19253]
   Other proteins in same PDB: d1fs1b2, d1fs1d2

Details for d1fs1d1

PDB Entry: 1fs1, 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1d1:

Sequence; same for both SEQRES and ATOM records:

>d1fs1d1 a.122.1.1 (D:84-140) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

Timeline for d1fs1d1:

• d1fs1d1 appears in SCOP 1.57
  
• d1fs1d1 appears in the current release, SCOPe 2.08