SCOPe 2.06: Domain d4g5ia_: 4g5i A:

Lineage for d4g5ia_ (4g5i A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries)

8. Domain d4g5ia_: 4g5i A: [192529]
   automated match to d1hn4b_
   complexed with ca, cl, db7

Details for d4g5ia_

PDB Entry: 4g5i, 2.4 Å

PDB Description: Crystal Structure of Porcine pancreatic PlA2 in complex with DBP

PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d4g5ia_:

Sequence; same for both SEQRES and ATOM records:

>d4g5ia_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

Timeline for d4g5ia_:

• d4g5ia_ first appeared in SCOPe 2.02
  
• d4g5ia_ appears in SCOPe 2.05
  
• d4g5ia_ appears in SCOPe 2.07
  
• d4g5ia_ appears in the current release, SCOPe 2.08