Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries) |
Domain d4hbxa_: 4hbx A: [192524] automated match to d3u5la_ complexed with 14x |
PDB Entry: 4hbx (more details), 1.62 Å
SCOPe Domain Sequences for d4hbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hbxa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki nelptee
Timeline for d4hbxa_: