Lineage for d1fs1b1 (1fs1 B:86-140)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156209Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)
  4. 156210Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family) (S)
  5. 156211Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)
  6. 156212Protein Skp1-Skp2 dimerisation domains [48505] (1 species)
  7. 156213Species Human (Homo sapiens) [TaxId:9606] [48506] (4 PDB entries)
  8. 156215Domain d1fs1b1: 1fs1 B:86-140 [19252]
    Other proteins in same PDB: d1fs1b2, d1fs1d2

Details for d1fs1b1

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1b1 a.122.1.1 (B:86-140) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

SCOP Domain Coordinates for d1fs1b1:

Click to download the PDB-style file with coordinates for d1fs1b1.
(The format of our PDB-style files is described here.)

Timeline for d1fs1b1: