SCOPe 2.06: Domain d3taya1: 3tay A:64-224

Lineage for d3taya1 (3tay A:64-224)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
   automatically mapped to Pfam PF00426

6. Protein automated matches [190699] (3 species)
   not a true protein

7. Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries)

8. Domain d3taya1: 3tay A:64-224 [192512]
   Other proteins in same PDB: d3taya2, d3tayb2
   automated match to d2i2sa_
   complexed with ben, epe, mn0, mpd, na, so4

Details for d3taya1

PDB Entry: 3tay, 1.85 Å

PDB Description: crystal structure of porcine rotavirus crw-8 vp8* in complex with n- glycolylneuraminic acid

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d3taya1:

Sequence; same for both SEQRES and ATOM records:

>d3taya1 b.29.1.14 (A:64-224) automated matches {Porcine rotavirus [TaxId: 31578]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

Timeline for d3taya1:

• d3taya1 first appeared in SCOPe 2.02, called d3taya_
  
• d3taya1 was called d3taya_ in SCOPe 2.05
  
• d3taya1 appears in SCOPe 2.07
  
• d3taya1 appears in the current release, SCOPe 2.08