Lineage for d4h9pb_ (4h9p B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1082937Domain d4h9pb_: 4h9p B: [192510]
    Other proteins in same PDB: d4h9pa_
    automated match to d1kx5b_
    protein/DNA complex; complexed with po4

Details for d4h9pb_

PDB Entry: 4h9p (more details), 2.2 Å

PDB Description: Complex structure 3 of DAXX/H3.3(sub5,G90A)/H4
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d4h9pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9pb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d4h9pb_:

Click to download the PDB-style file with coordinates for d4h9pb_.
(The format of our PDB-style files is described here.)

Timeline for d4h9pb_: