| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
| Domain d4h9pb_: 4h9p B: [192510] Other proteins in same PDB: d4h9pa_ automated match to d1kx5b_ protein/DNA complex; complexed with po4 |
PDB Entry: 4h9p (more details), 2.2 Å
SCOPe Domain Sequences for d4h9pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h9pb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg
Timeline for d4h9pb_: