Class a: All alpha proteins [46456] (218 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (3 proteins) |
Protein Skp2 [81379] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries) |
Domain d1fs1c1: 1fs1 C:109-149 [19251] Other proteins in same PDB: d1fs1b1, d1fs1b2, d1fs1d1, d1fs1d2 |
PDB Entry: 1fs1 (more details), 1.8 Å
SCOP Domain Sequences for d1fs1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs1c1 a.158.1.1 (C:109-149) Skp2 {Human (Homo sapiens)} wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw
Timeline for d1fs1c1: