Lineage for d1fs1c1 (1fs1 C:109-149)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449985Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 449986Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 449987Family a.158.1.1: F-box domain [81381] (3 proteins)
  6. 449995Protein Skp2 [81379] (1 species)
  7. 449996Species Human (Homo sapiens) [TaxId:9606] [81377] (4 PDB entries)
  8. 449998Domain d1fs1c1: 1fs1 C:109-149 [19251]
    Other proteins in same PDB: d1fs1b1, d1fs1b2, d1fs1d1, d1fs1d2

Details for d1fs1c1

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1c1 a.158.1.1 (C:109-149) Skp2 {Human (Homo sapiens)}
wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw

SCOP Domain Coordinates for d1fs1c1:

Click to download the PDB-style file with coordinates for d1fs1c1.
(The format of our PDB-style files is described here.)

Timeline for d1fs1c1: