![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
![]() | Domain d4h9rb_: 4h9r B: [192509] Other proteins in same PDB: d4h9ra_ automated match to d1kx5b_ protein/DNA complex; complexed with po4 |
PDB Entry: 4h9r (more details), 2.2 Å
SCOPe Domain Sequences for d4h9rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h9rb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]} kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk tvtamdvvyalkrqgrtlygfgg
Timeline for d4h9rb_: