SCOPe 2.04: Domain d4etwd_: 4etw D:

Lineage for d4etwd_ (4etw D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein Acyl carrier protein [47338] (6 species)

7. Species Shigella flexneri [TaxId:373384] [192502] (1 PDB entry)

8. Domain d4etwd_: 4etw D: [192503]
   Other proteins in same PDB: d4etwa_, d4etwc_
   automated match to d1t8ka_
   complexed with zmk

Details for d4etwd_

PDB Entry: 4etw, 2.05 Å

PDB Description: structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis

PDB Compounds: (D:) Acyl carrier protein

SCOPe Domain Sequences for d4etwd_:

Sequence; same for both SEQRES and ATOM records:

>d4etwd_ a.28.1.1 (D:) Acyl carrier protein {Shigella flexneri [TaxId: 373384]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyingh

Timeline for d4etwd_:

• d4etwd_ first appeared in SCOPe 2.02
  
• d4etwd_ appears in SCOPe 2.03
  
• d4etwd_ appears in SCOPe 2.05
  
• d4etwd_ appears in the current release, SCOPe 2.08