Lineage for d1fs1a1 (1fs1 A:109-149)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50815Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)
  4. 50816Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family) (S)
  5. 50817Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)
  6. 50818Protein Skp1-Skp2 dimerisation domains [48505] (1 species)
  7. 50819Species Human (Homo sapiens) [TaxId:9606] [48506] (3 PDB entries)
  8. 50820Domain d1fs1a1: 1fs1 A:109-149 [19250]
    Other proteins in same PDB: d1fs1b2, d1fs1d2

Details for d1fs1a1

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1a1 a.122.1.1 (A:109-149) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw

SCOP Domain Coordinates for d1fs1a1:

Click to download the PDB-style file with coordinates for d1fs1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fs1a1: