SCOPe 2.07: Domain d4h9nb_: 4h9n B:

Lineage for d4h9nb_ (4h9n B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (36 PDB entries)

8. Domain d4h9nb_: 4h9n B: [192497]
   Other proteins in same PDB: d4h9na_
   automated match to d1kx5b_
   protein/DNA complex; complexed with po4

Details for d4h9nb_

PDB Entry: 4h9n, 1.95 Å

PDB Description: Complex structure 1 of DAXX/H3.3(sub5)/H4

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d4h9nb_:

Sequence; same for both SEQRES and ATOM records:

>d4h9nb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

Timeline for d4h9nb_:

• d4h9nb_ first appeared in SCOPe 2.02
  
• d4h9nb_ appears in SCOPe 2.06
  
• d4h9nb_ appears in the current release, SCOPe 2.08