Lineage for d1qpia2 (1qpi A:68-206)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6301Fold a.121: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48497] (1 superfamily)
  4. 6302Superfamily a.121.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48498] (1 family) (S)
  5. 6303Family a.121.1.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48499] (1 protein)
  6. 6304Protein Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48500] (1 species)
  7. 6305Species Escherichia coli [TaxId:562] [48501] (9 PDB entries)
  8. 6315Domain d1qpia2: 1qpi A:68-206 [19249]
    Other proteins in same PDB: d1qpia1

Details for d1qpia2

PDB Entry: 1qpi (more details), 2.5 Å

PDB Description: crystal structure of tetracycline repressor/operator complex

SCOP Domain Sequences for d1qpia2:

Sequence, based on SEQRES records: (download)

>d1qpia2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallq

Sequence, based on observed residues (ATOM records): (download)

>d1qpia2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalenlppllrealqimdsddgeqaflhgleslir
gfevqltallq

SCOP Domain Coordinates for d1qpia2:

Click to download the PDB-style file with coordinates for d1qpia2.
(The format of our PDB-style files is described here.)

Timeline for d1qpia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qpia1