Lineage for d1qpia2 (1qpi A:68-206)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008349Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2008350Species Escherichia coli [TaxId:562] [48501] (28 PDB entries)
  8. 2008380Domain d1qpia2: 1qpi A:68-206 [19249]
    Other proteins in same PDB: d1qpia1
    protein/DNA complex; complexed with imd

Details for d1qpia2

PDB Entry: 1qpi (more details), 2.5 Å

PDB Description: crystal structure of tetracycline repressor/operator complex
PDB Compounds: (A:) protein (tetracycline repressor)

SCOPe Domain Sequences for d1qpia2:

Sequence, based on SEQRES records: (download)

>d1qpia2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallq

Sequence, based on observed residues (ATOM records): (download)

>d1qpia2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalenlppllrealqimdsddgeqaflhgleslir
gfevqltallq

SCOPe Domain Coordinates for d1qpia2:

Click to download the PDB-style file with coordinates for d1qpia2.
(The format of our PDB-style files is described here.)

Timeline for d1qpia2: