SCOPe 2.04: Domain d4gf9d_: 4gf9 D:

Lineage for d4gf9d_ (4gf9 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (28 PDB entries)

8. Domain d4gf9d_: 4gf9 D: [192487]
   automated match to d3ng4a_
   complexed with gol, lp5, ste

Details for d4gf9d_

PDB Entry: 4gf9, 2.8 Å

PDB Description: Structural insights into the dual strategy of recognition of peptidoglycan recognition protein, PGRP-S: ternary complex of PGRP-S with LPS and fatty acid

PDB Compounds: (D:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d4gf9d_:

Sequence; same for both SEQRES and ATOM records:

>d4gf9d_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d4gf9d_:

• d4gf9d_ first appeared in SCOPe 2.02
  
• d4gf9d_ appears in SCOPe 2.03
  
• d4gf9d_ appears in SCOPe 2.05
  
• d4gf9d_ appears in the current release, SCOPe 2.08