Lineage for d4gf9b_ (4gf9 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216883Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1216884Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1216885Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1216946Protein automated matches [190549] (3 species)
    not a true protein
  7. 1216947Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (23 PDB entries)
  8. 1217034Domain d4gf9b_: 4gf9 B: [192486]
    automated match to d3ng4a_
    complexed with gol, lp5, ste

Details for d4gf9b_

PDB Entry: 4gf9 (more details), 2.8 Å

PDB Description: Structural insights into the dual strategy of recognition of peptidoglycan recognition protein, PGRP-S: ternary complex of PGRP-S with LPS and fatty acid
PDB Compounds: (B:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d4gf9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gf9b_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d4gf9b_:

Click to download the PDB-style file with coordinates for d4gf9b_.
(The format of our PDB-style files is described here.)

Timeline for d4gf9b_: