Lineage for d4b0mb_ (4b0m B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 protein domains)
  6. 1300685Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 1300686Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)
  8. 1300688Domain d4b0mb_: 4b0m B: [192485]
    Other proteins in same PDB: d4b0ma_, d4b0mm1, d4b0mm2
    automated match to d1z9sb1

Details for d4b0mb_

PDB Entry: 4b0m (more details), 1.8 Å

PDB Description: Complex of the Caf1AN usher domain, Caf1M chaperone and Caf1 subunit from Yersinia pestis
PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d4b0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b0mb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf
tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla
agkytdavtvtvsnq

SCOPe Domain Coordinates for d4b0mb_:

Click to download the PDB-style file with coordinates for d4b0mb_.
(The format of our PDB-style files is described here.)

Timeline for d4b0mb_: