SCOPe 2.02: Domain d4b0mb_: 4b0m B:

Lineage for d4b0mb_ (4b0m B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein F1 capsule antigen Caf1 [89213] (1 species)

7. Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)

8. Domain d4b0mb_: 4b0m B: [192485]
   automated match to d1z9sb1

Details for d4b0mb_

PDB Entry: 4b0m, 1.8 Å

PDB Description: complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis

PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d4b0mb_:

Sequence; same for both SEQRES and ATOM records:

>d4b0mb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf
tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla
agkytdavtvtvsnq

Timeline for d4b0mb_:

• d4b0mb_ is new in SCOPe 2.02-stable
  
• d4b0mb_ appears in SCOPe 2.03
  
• d4b0mb_ appears in the current release, SCOPe 2.08