SCOPe 2.02: Domain d4az8b_: 4az8 B:

Lineage for d4az8b_ (4az8 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein F1 capsule antigen Caf1 [89213] (1 species)

7. Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)

8. Domain d4az8b_: 4az8 B: [192484]
   automated match to d1z9sb1

Details for d4az8b_

PDB Entry: 4az8, 2.65 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region

PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d4az8b_:

Sequence, based on SEQRES records:

>d4az8b_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf
tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla
agkytdavtvtvsn

Sequence, based on observed residues (ATOM records):

>d4az8b_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
eparitltykegapitinidtellvgtltlggyktstsvnftdaagdpmyltftsqdgnn
hqfttkvigkdsdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagkytdav
tvtvsn

Timeline for d4az8b_:

• d4az8b_ is new in SCOPe 2.02-stable
  
• d4az8b_ appears in SCOPe 2.03
  
• d4az8b_ appears in the current release, SCOPe 2.08