Lineage for d4ayfb_ (4ayf B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300685Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 1300686Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)
  8. 1300691Domain d4ayfb_: 4ayf B: [192483]
    Other proteins in same PDB: d4ayfa1, d4ayfa2
    automated match to d1z9sb1
    mutant

Details for d4ayfb_

PDB Entry: 4ayf (more details), 2.07 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d4ayfb_:

Sequence, based on SEQRES records: (download)

>d4ayfb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmylt
ftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkl
aagkytdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d4ayfb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitiidtellvgtltlggykttstsvnftdaagdpmyltftsqdgn
nhqfttkvigkfdispkvngenlvdvvlatgsqdffvrsigskgglaagkytdavtvtvs
nq

SCOPe Domain Coordinates for d4ayfb_:

Click to download the PDB-style file with coordinates for d4ayfb_.
(The format of our PDB-style files is described here.)

Timeline for d4ayfb_: