SCOPe 2.02: Domain d4ayfb_: 4ayf B:

Lineage for d4ayfb_ (4ayf B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein F1 capsule antigen Caf1 [89213] (1 species)

7. Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries)

8. Domain d4ayfb_: 4ayf B: [192483]
   automated match to d1z9sb1
   mutant

Details for d4ayfb_

PDB Entry: 4ayf, 2.07 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone

PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d4ayfb_:

Sequence, based on SEQRES records:

>d4ayfb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmylt
ftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkl
aagkytdavtvtvsnq

Sequence, based on observed residues (ATOM records):

>d4ayfb_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
veparitltykegapitiidtellvgtltlggykttstsvnftdaagdpmyltftsqdgn
nhqfttkvigkfdispkvngenlvdvvlatgsqdffvrsigskgglaagkytdavtvtvs
nq

Timeline for d4ayfb_:

• d4ayfb_ is new in SCOPe 2.02-stable
  
• d4ayfb_ appears in SCOPe 2.03
  
• d4ayfb_ appears in the current release, SCOPe 2.08