Lineage for d1du7a2 (1du7 A:68-208)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217395Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 217396Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 217397Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 217428Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 217429Species Escherichia coli [TaxId:562] [48501] (9 PDB entries)
  8. 217438Domain d1du7a2: 1du7 A:68-208 [19248]
    Other proteins in same PDB: d1du7a1
    class d; complex with 4-epi-tetracycline
    complexed with ctc; mutant

Details for d1du7a2

PDB Entry: 1du7 (more details), 2.51 Å

PDB Description: crystal structure of tet repressor class d with 4-epi-tetracycline

SCOP Domain Sequences for d1du7a2:

Sequence, based on SEQRES records: (download)

>d1du7a2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d1du7a2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtadenlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

SCOP Domain Coordinates for d1du7a2:

Click to download the PDB-style file with coordinates for d1du7a2.
(The format of our PDB-style files is described here.)

Timeline for d1du7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1du7a1