Lineage for d3tj2a_ (3tj2 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1088952Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1088953Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1088954Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1088961Protein MDM2 [47594] (2 species)
  7. 1088965Species Human (Homo sapiens) [TaxId:9606] [47596] (25 PDB entries)
  8. 1088989Domain d3tj2a_: 3tj2 A: [192477]
    automated match to d1t4ea_
    protein/DNA complex; complexed with k, tj2

Details for d3tj2a_

PDB Entry: 3tj2 (more details), 2.1 Å

PDB Description: structure of a novel submicromolar mdm2 inhibitor
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3tj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tj2a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
aseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsnd
llgdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d3tj2a_:

Click to download the PDB-style file with coordinates for d3tj2a_.
(The format of our PDB-style files is described here.)

Timeline for d3tj2a_: