SCOPe 2.02: Domain d3tj2c_: 3tj2 C:

Lineage for d3tj2c_ (3tj2 C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (25 PDB entries)

8. Domain d3tj2c_: 3tj2 C: [192476]
   automated match to d1t4ea_
   protein/DNA complex; complexed with k, tj2

Details for d3tj2c_

PDB Entry: 3tj2, 2.1 Å

PDB Description: structure of a novel submicromolar mdm2 inhibitor

PDB Compounds: (C:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3tj2c_:

Sequence; same for both SEQRES and ATOM records:

>d3tj2c_ a.42.1.1 (C:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d3tj2c_:

• d3tj2c_ is new in SCOPe 2.02-stable
  
• d3tj2c_ appears in SCOPe 2.03
  
• d3tj2c_ appears in the current release, SCOPe 2.08