Lineage for d4flma_ (4flm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135982Family c.69.1.34: Hypothetical esterase YJL068C [117714] (2 protein domains)
    part of Pfam PF00756
  6. 2135989Protein automated matches [190952] (2 species)
    not a true protein
  7. 2135995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [188551] (2 PDB entries)
  8. 2135997Domain d4flma_: 4flm A: [192466]
    automated match to d3c6ba_
    complexed with cu

Details for d4flma_

PDB Entry: 4flm (more details), 2.41 Å

PDB Description: S-formylglutathione Hydrolase W197I Variant containing Copper
PDB Compounds: (A:) S-formylglutathione hydrolase

SCOPe Domain Sequences for d4flma_:

Sequence, based on SEQRES records: (download)

>d4flma_ c.69.1.34 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mkvvkefsvcggrliklshnsnstktsmnvniylpkhyyaqdfprnkriptvfylsgltc
tpdnasekafwqfqadkygfaivfpdtsprgdevandpegswdfgqgagfylnatqepya
qhyqmydyihkelpqtldshfnkngdvkldfldnvaitghsmggygaicgylkgysgkry
kscsafapivnpsnvpigqkafkgylgeekaqweaydpclliknirhvgddrilihvgds
dpfleehlkpellleavkatswqdyveikkvhgfdhsyyfvstfvpehaefharnlgli

Sequence, based on observed residues (ATOM records): (download)

>d4flma_ c.69.1.34 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mkvvkefsvcggrliklshnsnstktsmnvniylpkhyyaqdnkriptvfylsgltctpd
nasekafwqfqadkygfaivfpdtsprggswdfgqgagfylnatqepyaqhyqmydyihk
elpqtldshfnkngdvkldfldnvaitghsmggygaicgylkgysgkrykscsafapivn
psnvpigqkafkgylgeekaqweaydpclliknirhvgddrilihvgdsdpfleehlkpe
llleavkatswqdyveikkvhgfdhsyyfvstfvpehaefharnlgli

SCOPe Domain Coordinates for d4flma_:

Click to download the PDB-style file with coordinates for d4flma_.
(The format of our PDB-style files is described here.)

Timeline for d4flma_: