Lineage for d1bjya2 (1bjy A:68-208)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6301Fold a.121: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48497] (1 superfamily)
  4. 6302Superfamily a.121.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48498] (1 family) (S)
  5. 6303Family a.121.1.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48499] (1 protein)
  6. 6304Protein Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48500] (1 species)
  7. 6305Species Escherichia coli [TaxId:562] [48501] (9 PDB entries)
  8. 6312Domain d1bjya2: 1bjy A:68-208 [19246]
    Other proteins in same PDB: d1bjya1, d1bjyb1

Details for d1bjya2

PDB Entry: 1bjy (more details), 2.7 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

SCOP Domain Sequences for d1bjya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjya2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

SCOP Domain Coordinates for d1bjya2:

Click to download the PDB-style file with coordinates for d1bjya2.
(The format of our PDB-style files is described here.)

Timeline for d1bjya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjya1