Lineage for d1ork_2 (1ork 68-208)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447981Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 447982Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 447983Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 448061Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 448062Species Escherichia coli [TaxId:562] [48501] (9 PDB entries)
  8. 448067Domain d1ork_2: 1ork 68-208 [19244]
    Other proteins in same PDB: d1ork_1

Details for d1ork_2

PDB Entry: 1ork (more details), 2.4 Å

PDB Description: tet repressor, class d in complex with 9-(n,n-dimethylglycylamido)-6-demethyl-6-deoxy-tetracycline

SCOP Domain Sequences for d1ork_2:

Sequence, based on SEQRES records: (download)

>d1ork_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d1ork_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaanlppllrealqimdsddgeqaflhgleslirgf
evqltallqiv

SCOP Domain Coordinates for d1ork_2:

Click to download the PDB-style file with coordinates for d1ork_2.
(The format of our PDB-style files is described here.)

Timeline for d1ork_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ork_1