| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
| Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species) |
| Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries) Uniprot P71143 30-191! Uniprot P71143 30-195 |
| Domain d4fl4b_: 4fl4 B: [192430] Other proteins in same PDB: d4fl4a1, d4fl4a2, d4fl4d1, d4fl4d2, d4fl4g1, d4fl4g2, d4fl4j1, d4fl4j2 complexed with ca, so4 |
PDB Entry: 4fl4 (more details), 2.8 Å
SCOPe Domain Sequences for d4fl4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fl4b_ b.2.2.2 (B:) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
Timeline for d4fl4b_: