Lineage for d4fl4b_ (4fl4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767311Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)
  7. 2767312Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries)
    Uniprot P71143 30-191! Uniprot P71143 30-195
  8. 2767315Domain d4fl4b_: 4fl4 B: [192430]
    Other proteins in same PDB: d4fl4a1, d4fl4a2, d4fl4d1, d4fl4d2, d4fl4g1, d4fl4g2, d4fl4j1, d4fl4j2
    complexed with ca, so4

Details for d4fl4b_

PDB Entry: 4fl4 (more details), 2.8 Å

PDB Description: Scaffoldin conformation and dynamics revealed by a ternary complex from the Clostridium thermocellum cellulosome
PDB Compounds: (B:) scaffolding dockerin binding protein a

SCOPe Domain Sequences for d4fl4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fl4b_ b.2.2.2 (B:) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

SCOPe Domain Coordinates for d4fl4b_:

Click to download the PDB-style file with coordinates for d4fl4b_.
(The format of our PDB-style files is described here.)

Timeline for d4fl4b_: