SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4fl4b_ (4fl4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033774Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2033788Family b.2.2.2: Cellulose-binding domain family III [49390] (9 protein domains)
    Pfam PF00963
  6. 2033859Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)
  7. 2033860Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries)
    Uniprot P71143 30-191! Uniprot P71143 30-195
  8. 2033863Domain d4fl4b_: 4fl4 B: [192430]
    Other proteins in same PDB: d4fl4a1, d4fl4a2, d4fl4d1, d4fl4d2, d4fl4g1, d4fl4g2, d4fl4j1, d4fl4j2
    complexed with ca, so4

Details for d4fl4b_

PDB Entry: 4fl4 (more details), 2.8 Å

PDB Description: Scaffoldin conformation and dynamics revealed by a ternary complex from the Clostridium thermocellum cellulosome
PDB Compounds: (B:) scaffolding dockerin binding protein a

SCOPe Domain Sequences for d4fl4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fl4b_ b.2.2.2 (B:) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

SCOPe Domain Coordinates for d4fl4b_:

Click to download the PDB-style file with coordinates for d4fl4b_.
(The format of our PDB-style files is described here.)

Timeline for d4fl4b_: