SCOPe 2.07: Domain d4f7ic1: 4f7i C:1-345

Lineage for d4f7ic1 (4f7i C:1-345)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [192453] (1 PDB entry)

8. Domain d4f7ic1: 4f7i C:1-345 [192423]
   Other proteins in same PDB: d4f7ia2, d4f7ia3, d4f7ib2, d4f7ib3, d4f7ic2, d4f7ic3, d4f7id2, d4f7id3
   automated match to d1xaaa_
   complexed with eoh, gol, ipm, k, mn, mpo, nad

Details for d4f7ic1

PDB Entry: 4f7i, 2 Å

PDB Description: structure of isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh

PDB Compounds: (C:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4f7ic1:

Sequence; same for both SEQRES and ATOM records:

>d4f7ic1 c.77.1.1 (C:1-345) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

Timeline for d4f7ic1:

• d4f7ic1 first appeared in SCOPe 2.02, called d4f7ic_
  
• d4f7ic1 appears in SCOPe 2.06
  
• d4f7ic1 appears in the current release, SCOPe 2.08