Lineage for d1bjz_2 (1bjz 68-208)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.121: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48497] (1 superfamily) Superfamily a.121.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48498] (1 family) 
Family a.121.1.1: Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48499] (1 protein) Protein Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain [48500] (1 species) Species Escherichia coli [TaxId:562] [48501] (9 PDB entries) 
Domain d1bjz_2: 1bjz 68-208 [19242]
Other proteins in same PDB: d1bjz_1
Details for d1bjz_2
PDB Entry: 1bjz (more details), 2.2 Å
PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction
SCOP Domain Sequences for d1bjz_2:
Sequence, based on SEQRES records: (download)
>d1bjz_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Sequence, based on observed residues (ATOM records): (download)
>d1bjz_2 a.121.1.1 (68-208) Tetracyclin repressor (Tet-repressor, TetR), C-terminal domain {Escherichia coli}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehnlppllrealqimdsddgeqaflhgleslirgfevq
ltallqiv
SCOP Domain Coordinates for d1bjz_2:
Click to download the PDB-style file with coordinates for d1bjz_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bjz_2:
- d1bjz_2 appears in SCOP 1.57
- d1bjz_2 appears in the current release, SCOPe 2.08, called d1bjza2
View in 3D
