SCOPe 2.07: Domain d4f4jb1: 4f4j B:1-185

Lineage for d4f4jb1 (4f4j B:1-185)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189750] (1 PDB entry)

8. Domain d4f4jb1: 4f4j B:1-185 [192416]
   Other proteins in same PDB: d4f4ja2, d4f4jb2
   complexed with so4; mutant

Details for d4f4jb1

PDB Entry: 4f4j, 2.45 Å

PDB Description: Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing

PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d4f4jb1:

Sequence, based on SEQRES records:

>d4f4jb1 c.37.1.1 (B:1-185) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsvdefk
smiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflf
iappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkaykelk
dfifa

Sequence, based on observed residues (ATOM records):

>d4f4jb1 c.37.1.1 (B:1-185) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsvdefk
smiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflf
iappsvedlkkkrlsaaqaelayaetgahdkvivnddldkaykelkdfifa

Timeline for d4f4jb1:

• d4f4jb1 first appeared in SCOPe 2.02, called d4f4jb_
  
• d4f4jb1 appears in SCOPe 2.06
  
• d4f4jb1 appears in the current release, SCOPe 2.08