Lineage for d4f4jb_ (4f4j B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593811Protein Guanylate kinase [52542] (5 species)
  7. 1593817Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189750] (1 PDB entry)
  8. 1593819Domain d4f4jb_: 4f4j B: [192416]
    complexed with so4; mutant

Details for d4f4jb_

PDB Entry: 4f4j (more details), 2.45 Å

PDB Description: Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing
PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d4f4jb_:

Sequence, based on SEQRES records: (download)

>d4f4jb_ c.37.1.1 (B:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dydipttenlyfqgsmsrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtprage
vngkdynfvsvdefksmiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgv
ksvkaipelnarflfiappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdk
vivnddldkaykelkdfifa

Sequence, based on observed residues (ATOM records): (download)

>d4f4jb_ c.37.1.1 (B:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dydipttenlyfqgsmsrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtprage
vngkdynfvsvdefksmiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgv
ksvkaipelnarflfiappsvedlkkkrlsaaqaelayaetgahdkvivnddldkaykel
kdfifa

SCOPe Domain Coordinates for d4f4jb_:

Click to download the PDB-style file with coordinates for d4f4jb_.
(The format of our PDB-style files is described here.)

Timeline for d4f4jb_: