![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Guanylate kinase [52542] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189750] (1 PDB entry) |
![]() | Domain d4f4ja_: 4f4j A: [192415] complexed with so4; mutant |
PDB Entry: 4f4j (more details), 2.45 Å
SCOPe Domain Sequences for d4f4ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f4ja_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} fqgsmsrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsv defksmiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelna rflfiappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkay kelkdfifa
Timeline for d4f4ja_: