SCOPe 2.05: Domain d4f4ja_: 4f4j A:

Lineage for d4f4ja_ (4f4j A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189750] (1 PDB entry)

8. Domain d4f4ja_: 4f4j A: [192415]
   complexed with so4; mutant

Details for d4f4ja_

PDB Entry: 4f4j, 2.45 Å

PDB Description: Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing

PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d4f4ja_:

Sequence; same for both SEQRES and ATOM records:

>d4f4ja_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
fqgsmsrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsv
defksmiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelna
rflfiappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkay
kelkdfifa

Timeline for d4f4ja_:

• d4f4ja_ first appeared in SCOPe 2.02
  
• d4f4ja_ appears in SCOPe 2.04
  
• d4f4ja_ is called d4f4ja1 in SCOPe 2.06
  
• d4f4ja_ appears in the current release, SCOPe 2.08, called d4f4ja1