Lineage for d4f4ja1 (4f4j A:1-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865978Protein Guanylate kinase [52542] (5 species)
  7. 2865991Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189750] (1 PDB entry)
  8. 2865992Domain d4f4ja1: 4f4j A:1-185 [192415]
    Other proteins in same PDB: d4f4ja2, d4f4jb2
    complexed with so4; mutant

Details for d4f4ja1

PDB Entry: 4f4j (more details), 2.45 Å

PDB Description: Conversion of the enzyme guanylate kinase into a mitotic spindle orienting protein by a single mutation that inhibits gmp- induced closing
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d4f4ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f4ja1 c.37.1.1 (A:1-185) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsvdefk
smiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflf
iappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkaykelk
dfifa

SCOPe Domain Coordinates for d4f4ja1:

Click to download the PDB-style file with coordinates for d4f4ja1.
(The format of our PDB-style files is described here.)

Timeline for d4f4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f4ja2